Active Recombinant Human KITLG Protein

Cat.No. : KITLG-199H
Product Overview : Recombinant Human KITLG Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Stem cell factor (SCF) is a cytokine made by fibroblasts and endothelial cells. SCF binds to the receptor c-Kit/CD117 and plays a critical role in the maintenance, survival, and differentiation of hematopoietic stem cells. While human SCF shows no activity on murine cells, murine and rat SCF are active on human cells.
Bio-activity : TF-1 cell proliferation, ≤15 ng/mL; ≥6.7 x 10^4 units/mg
Molecular Mass : Monomer, 18.6 kDa (165 aa)
AA Sequence : MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5.
Reconstitution : Sterile water at 0.1 mg/mL.
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name KITLG KIT ligand [ Homo sapiens (human) ]
Official Symbol KITLG
Synonyms KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250;
Gene ID 4254
mRNA Refseq NM_000899
Protein Refseq NP_000890
MIM 184745
UniProt ID P21583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KITLG Products

Required fields are marked with *

My Review for All KITLG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon