Recombinant Full Length Cat Kit Ligand(Kitlg) Protein, His-Tagged
Cat.No. : | RFL9710FF |
Product Overview : | Recombinant Full Length Cat Kit ligand(KITLG) Protein (P79169) (26-274aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Felis catus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-274) |
Form : | Lyophilized powder |
AA Sequence : | KGLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KITLG |
Synonyms | KITLG; SCF; Kit ligand; Mast cell growth factor; MGF; Stem cell factor; c-Kit ligand |
UniProt ID | P79169 |
◆ Recombinant Proteins | ||
Kitl-792M | Recombinant Mouse Kitl protein, His-tagged | +Inquiry |
Kitlg-793R | Recombinant Rat Kitlg protein, His-tagged | +Inquiry |
KITLG-5873H | Recombinant Human KITLG protein | +Inquiry |
RFL23935HF | Recombinant Full Length Human Kit Ligand(Kitlg) Protein, His-Tagged | +Inquiry |
KITLG-19H | Active Recombinant Human KITLG Protein, Pre-aliquoted | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *