Active Recombinant Human PDGFDD Protein
| Cat.No. : | PDGFD-209P |
| Product Overview : | Recombinant Human PDGFDD Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Description : | PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 5 μg/mL, measured in a cell proliferation assay using 3T3 cells. |
| Molecular Mass : | 19-21 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | PDGFD platelet derived growth factor D [ Homo sapiens ] |
| Official Symbol | PDGFD |
| Synonyms | PDGFD; platelet derived growth factor D; platelet-derived growth factor D; IEGF; MSTP036; SCDGF B; spinal cord derived growth factor B; PDGF-D; iris-expressed growth factor; spinal cord-derived growth factor B; spinal cord-derived growth factor-B; SCDGFB; SCDGF-B; MGC26867; |
| Gene ID | 80310 |
| mRNA Refseq | NM_025208 |
| Protein Refseq | NP_079484 |
| MIM | 609673 |
| UniProt ID | Q9GZP0 |
| ◆ Recombinant Proteins | ||
| PDGFD-3231H | Recombinant Human PDGFD protein, His-tagged | +Inquiry |
| PDGFD-3999R | Recombinant Rat PDGFD Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pdgfd-8157R | Recombinant Rat Pdgfd protein, His-tagged | +Inquiry |
| PDGFD-097H | Active Recombinant Human PDGFD Protein | +Inquiry |
| PDGFD-12569M | Recombinant Mouse Pdgfd Protein, Ser250-Arg370 | +Inquiry |
| ◆ Native Proteins | ||
| PDGFD-4339R | Recombinant Rat PDGFD Protein, His tagged, Homodimer | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFD-3336HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
| PDGFD-3335HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFD Products
Required fields are marked with *
My Review for All PDGFD Products
Required fields are marked with *



