Recombinant Rat PDGFD Protein, His tagged, Homodimer
| Cat.No. : | PDGFD-4339R |
| Product Overview : | Recombinant Rat PDGFD Protein (Homodimer) with His tag was expressed in HEK293. |
| Availability | December 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 250-370 aa |
| Description : | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. |
| AASequence : | SYHERKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTLNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPRHHHHHHHH |
| Molecular Mass : | 15 kDa |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.02 mg/mL by BCA |
| Gene Name | Pdgfd platelet derived growth factor D [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | PDGFD |
| Synonyms | PDGFD; platelet-derived growth factor, D polypeptide; platelet-derived growth factor D; PDGF-D; SCDGF-B; iris-expressed growth factor; spinal cord-derived growth factor B; spinal-cord derived growth factor-B protein; Scdgfb; rSCDGF-B; |
| Gene ID | 66018 |
| mRNA Refseq | NM_023962 |
| Protein Refseq | NP_076452 |
| UniProt ID | Q9EQT1 |
| ◆ Recombinant Proteins | ||
| PDGFD-097H | Active Recombinant Human PDGFD Protein | +Inquiry |
| PDGFD-4605H | Recombinant Human PDGFD protein, His-tagged | +Inquiry |
| PDGFD-3396H | Recombinant Human PDGFD protein, His-GST-tagged | +Inquiry |
| PDGFD-5169C | Recombinant Chicken PDGFD | +Inquiry |
| PDGFD-4339R | Recombinant Rat PDGFD Protein, His tagged, Homodimer | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFD-3335HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
| PDGFD-3336HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFD Products
Required fields are marked with *
My Review for All PDGFD Products
Required fields are marked with *
