Recombinant Rat PDGFD Protein, His tagged, Homodimer

• Cat.No.: PDGFD-4339R
• Product Overview: Recombinant Rat PDGFD Protein (Homodimer) with His tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 250-370 aa
• Description: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis.
• AASequence: SYHERKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTLNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPRHHHHHHHH
• Molecular Mass: 15 kDa
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.02 mg/mL by BCA

Gene Information

• Gene Name: Pdgfd platelet derived growth factor D [ Rattus norvegicus (Norway rat) ]
• Official Symbol: PDGFD
• Synonyms: PDGFD; platelet-derived growth factor, D polypeptide; platelet-derived growth factor D; PDGF-D; SCDGF-B; iris-expressed growth factor; spinal cord-derived growth factor B; spinal-cord derived growth factor-B protein; Scdgfb; rSCDGF-B
• Gene ID: 66018
• mRNA Refseq: NM_023962
• Protein Refseq: NP_076452
• UniProt ID: Q9EQT1