Recombinant Rat PDGFD Protein, His tagged, Homodimer

Cat.No. : PDGFD-4339R
Product Overview : Recombinant Rat PDGFD Protein (Homodimer) with His tag was expressed in HEK293.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Protein Length : 250-370 aa
Description : Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis.
AASequence : SYHERKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTLNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPRHHHHHHHH
Molecular Mass : 15 kDa
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.02 mg/mL by BCA
Gene Name Pdgfd platelet derived growth factor D [ Rattus norvegicus (Norway rat) ]
Official Symbol PDGFD
Synonyms PDGFD; platelet-derived growth factor, D polypeptide; platelet-derived growth factor D; PDGF-D; SCDGF-B; iris-expressed growth factor; spinal cord-derived growth factor B; spinal-cord derived growth factor-B protein; Scdgfb; rSCDGF-B;
Gene ID 66018
mRNA Refseq NM_023962
Protein Refseq NP_076452
UniProt ID Q9EQT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFD Products

Required fields are marked with *

My Review for All PDGFD Products

Required fields are marked with *

0
cart-icon
0
compare icon