Active Recombinant Human PF4 Protein (70 aa)

Cat.No. : PF4-061P
Product Overview : Recombinant Human PF4 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 70
Description : Platelet Factor 4, is a member of the CXC chemokine family, CXCL4. CXCL4 has homology with IL8 and βthromboglobulin. The active protein consists of a tetramer composed of individual CXCL4 subunits. Megakaryocytes synthesize CXCL4 and store it as tetramers in α-granules. The CXCL4 tetramers are secreted by activated platelets and can be measured at micromolar levels in serum. In contrast to other CXC chemokines, CXCL4 lacks chemotactic activity for polymorphonuclear granulocytes. CXCL4 does not contain an ELR motif. However, many other functions have been observed for CXCL4. CXCL4 is involved in monocyte survivial and differentiation into macrophages, and it has antiangiogenic activity. CXCL4 has been demonstrated to inhibit the binding of FGF2 to highaffinity receptors and its subsequent internalization. Cell surface neutrophil chondroitin sulfate chains serve as CXCL4 binding sites; affinity is controlled by the degree of sulfation of these chains.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R-3T3 mouse fibroblasts. The ED50 for this effect is typically 5-15 μg/mL.
Molecular Mass : Approximately 7.77 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
AA Sequence : EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Endotoxin : Less than 1 EU/μg of rHuPF-4 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, 1.5M NaCl, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name PF4 platelet factor 4 [ Homo sapiens (human) ]
Official Symbol PF4
Synonyms PF4; platelet factor 4; PF-4; CXCL4; SCYB4; platelet factor 4; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; iroplact; oncostatin-A
Gene ID 5196
mRNA Refseq NM_002619
Protein Refseq NP_002610
MIM 173460
UniProt ID P02776

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PF4 Products

Required fields are marked with *

My Review for All PF4 Products

Required fields are marked with *

0
cart-icon