Active Recombinant Mouse Pf4 Protein

Cat.No. : Pf4-4802M
Product Overview : Purified recombinant protein of Mouse platelet factor 4 (Pf4) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation.
Bio-activity : Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-100.0 ng/mL.
Molecular Mass : 8.2 kDa
AA Sequence : VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Pf4 platelet factor 4 [ Mus musculus (house mouse) ]
Official Symbol Pf4
Synonyms PF4; platelet factor 4; PF-4; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; Cxcl4; Scyb4
Gene ID 56744
mRNA Refseq NM_019932
Protein Refseq NP_064316
UniProt ID Q9Z126

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pf4 Products

Required fields are marked with *

My Review for All Pf4 Products

Required fields are marked with *

0
cart-icon
0
compare icon