Active Recombinant Mouse Pf4 Protein

• Cat.No.: Pf4-4802M
• Product Overview: Purified recombinant protein of Mouse platelet factor 4 (Pf4) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation.
• Bio-activity: Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-100.0 ng/mL.
• Molecular Mass: 8.2 kDa
• AA Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Pf4 platelet factor 4 [ Mus musculus (house mouse) ]
• Official Symbol: Pf4
• Synonyms: PF4; platelet factor 4; PF-4; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; Cxcl4; Scyb4
• Gene ID: 56744
• mRNA Refseq: NM_019932
• Protein Refseq: NP_064316
• UniProt ID: Q9Z126