Active Recombinant Mouse Pf4 Protein
| Cat.No. : | Pf4-4802M |
| Product Overview : | Purified recombinant protein of Mouse platelet factor 4 (Pf4) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation. |
| Bio-activity : | Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-100.0 ng/mL. |
| Molecular Mass : | 8.2 kDa |
| AA Sequence : | VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES |
| Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
| Gene Name | Pf4 platelet factor 4 [ Mus musculus (house mouse) ] |
| Official Symbol | Pf4 |
| Synonyms | PF4; platelet factor 4; PF-4; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; Cxcl4; Scyb4 |
| Gene ID | 56744 |
| mRNA Refseq | NM_019932 |
| Protein Refseq | NP_064316 |
| UniProt ID | Q9Z126 |
| ◆ Recombinant Proteins | ||
| Pf4-159M | Recombinant Mouse Pf4 Protein, His-tagged | +Inquiry |
| PF4-6754H | Recombinant Human PF4 protein, hFc-tagged | +Inquiry |
| Pf4-151M | Active Recombinant Mouse Pf4 protein, His-tagged | +Inquiry |
| PF4-151H | Recombinant Human PF4 Protein, DYKDDDDK-tagged | +Inquiry |
| Pf4-37M | Recombinant Mouse Pf4 Protein, Biotin-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PF4-3283HCL | Recombinant Human PF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pf4 Products
Required fields are marked with *
My Review for All Pf4 Products
Required fields are marked with *
