Active Recombinant Human VEGF165 Protein

• Cat.No.: VEGFA-161V
• Product Overview: Recombinant Human VEGF165 Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Vascular Endothelial Growth Factor is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the mouse homolog of KDR is the flk-1 gene product) and the flt4 gene product.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 16 ng/mL, measured in a cell proliferation assay using HUVEC cells.
• Molecular Mass: 20~26 kDa, observed by reducing SDS-PAGE.
• AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Vascular Endothelial Growth Factor 165 (VEGF-165) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor 165 (VEGF-165) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor, VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609
• Gene ID: 7422
• mRNA Refseq: NM_001025366
• Protein Refseq: NP_001020537
• MIM: 192240
• UniProt ID: P15692