Active Recombinant Human VEGF165 Protein
Cat.No. : | VEGFA-161V |
Product Overview : | Recombinant Human VEGF165 Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | Vascular Endothelial Growth Factor is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the mouse homolog of KDR is the flk-1 gene product) and the flt4 gene product. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 16 ng/mL, measured in a cell proliferation assay using HUVEC cells. |
Molecular Mass : | 20~26 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Vascular Endothelial Growth Factor 165 (VEGF-165) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor 165 (VEGF-165) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens ] |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor, VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609; |
Gene ID | 7422 |
mRNA Refseq | NM_001025366 |
Protein Refseq | NP_001020537 |
MIM | 192240 |
UniProt ID | P15692 |
◆ Recombinant Proteins | ||
VEGFA-543H | Active Recombinant Human VEGFA | +Inquiry |
VEGFA-557H | Recombinant Human VEGFA Protein, His-tagged | +Inquiry |
Vegfa-582M | Active Recombinant Mouse Vascular Endothelial Growth Factor A | +Inquiry |
VEGFA-0503H | Recombinant Human VEGFA Protein (V40-K134), Tag Free | +Inquiry |
VEGFA-136C | Active Recombinant Human/Cynomolgus VEGF165 protein (Met1-Arg191) | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
0
Inquiry Basket