Active Recombinant Mouse Btc Protein

Cat.No. : Btc-037M
Product Overview : Purified recombinant protein of Mouse betacellulin, epidermal growth factor family member (Btc) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a member of the epidermal growth factor (EGF) family. These growth factors are ligands for the EGFR/ErbB receptor tyrosine kinases, and play roles in cell growth and differentiation. The encoded protein is synthesized as a transmembrane precursor that is proteolytically cleaved to generate a mature peptide, and plays a role in the differentiation of pancreatic beta cells. This gene may also play a protective role in acute pancreatitis, whereas increased expression of this gene may contribute to diabetic macular edema. Gene therapy using combinations of this gene and other pancreas-specific transcription factors may induce islet neogenesis and remediate hyperglycemia in type 1 diabetes.
Bio-activity : Determined by its ability to stimulate the proliferation of mouse Balb/3T3 cells. The expected ED50 is less than or equal to 0.01 ng/ml, corresponding to a specific activity of > 1 x 10^8 units/mg.
Molecular Mass : 9 kDa
AA Sequence : DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Btc betacellulin, epidermal growth factor family member [ Mus musculus (house mouse) ]
Official Symbol Btc
Synonyms Btc; betacellulin, epidermal growth factor family member; Bcn; betacellulin; probetacellulin
Gene ID 12223
mRNA Refseq NM_007568
Protein Refseq NP_031594
UniProt ID Q05928

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Btc Products

Required fields are marked with *

My Review for All Btc Products

Required fields are marked with *

0
cart-icon