Species : |
Mouse |
Source : |
E.coli |
Description : |
This gene encodes a member of the epidermal growth factor (EGF) family. These growth factors are ligands for the EGFR/ErbB receptor tyrosine kinases, and play roles in cell growth and differentiation. The encoded protein is synthesized as a transmembrane precursor that is proteolytically cleaved to generate a mature peptide, and plays a role in the differentiation of pancreatic beta cells. This gene may also play a protective role in acute pancreatitis, whereas increased expression of this gene may contribute to diabetic macular edema. Gene therapy using combinations of this gene and other pancreas-specific transcription factors may induce islet neogenesis and remediate hyperglycemia in type 1 diabetes. |
Bio-activity : |
Determined by its ability to stimulate the proliferation of mouse Balb/3T3 cells. The expected ED50 is less than or equal to 0.01 ng/ml, corresponding to a specific activity of > 1 x 10^8 units/mg. |
Molecular Mass : |
9 kDa |
AA Sequence : |
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY |
Endotoxin : |
Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : |
>95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : |
Store at -80 centigrade. |
Storage Buffer : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : |
Resuspend the protein in the desired concentration in proper buffer. |