Recombinant Human BTC protein, GST-tagged
| Cat.No. : | BTC-2604H |
| Product Overview : | Recombinant Human BTC protein(P35070)(32-178aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 32-178aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.6 kDa |
| AA Sequence : | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BTC betacellulin [ Homo sapiens ] |
| Official Symbol | BTC |
| Synonyms | BTC; betacellulin; probetacellulin; |
| Gene ID | 685 |
| mRNA Refseq | NM_001729 |
| Protein Refseq | NP_001720 |
| MIM | 600345 |
| UniProt ID | P35070 |
| ◆ Recombinant Proteins | ||
| BTC-320B | Active Recombinant Bovine Betacellulin | +Inquiry |
| BTC-21H | Recombinant Human BTC protein | +Inquiry |
| BTC-106H | Recombinant Human BTC Protein, Fc-tagged | +Inquiry |
| BTC-439B | Active Recombinant Human BTC Protein (81 aa) | +Inquiry |
| BTC-3687H | Recombinant Human BTC protein, rFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
| BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
| BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *
