Recombinant Human BTC protein, GST-tagged
Cat.No. : | BTC-2604H |
Product Overview : | Recombinant Human BTC protein(P35070)(32-178aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 32-178aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.6 kDa |
AA Sequence : | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BTC betacellulin [ Homo sapiens ] |
Official Symbol | BTC |
Synonyms | BTC; betacellulin; probetacellulin; |
Gene ID | 685 |
mRNA Refseq | NM_001729 |
Protein Refseq | NP_001720 |
MIM | 600345 |
UniProt ID | P35070 |
◆ Recombinant Proteins | ||
BTC-10315H | Recombinant Human BTC, GST-tagged | +Inquiry |
BTC-1665HF | Recombinant Full Length Human BTC Protein, GST-tagged | +Inquiry |
Btc-438B | Active Recombinant Mouse Btc Protein (81 aa) | +Inquiry |
BTC-320B | Active Recombinant Bovine Betacellulin | +Inquiry |
BTC-135B | Active Recombinant Human BTC Protein (80 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *
0
Inquiry Basket