Active Recombinant Mouse Btc Protein (81 aa)

• Cat.No.: Btc-438B
• Product Overview: Recombinant mouse Betacellulin (rmBetacellulin) produced in E. coli is a single non-glycosylated polypeptide chain containing 81 amino acids. A fully biologically active molecule, rmBetacellulin has a molecular mass of 9.2 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 81
• Description: Betacellulin is a pleiotropic cytokine that belongs to the Epidermal Growth Factor (EGF) family. Like other members of the EGF family, Betacellulin possesses a conserved sequence of 35-40 amino acids which contain 3 disulfide bonds formed by 6 cysteines. Betacellulin is unique in the EGF family since it can bind and activate a broad spectrum of ErbB receptors. Functionally, Betacellulin plays a role in the development of the pancreas by activating signaling pathways beneficial for the function, survival and regeneration of pancreatic β-cells. Additionally, Betacellulin has potential angiogenic activities and is important for the growth, development and repair of certain tissues.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 ng/mL, measured by a cell proliferation assay using3T3cells, corresponding to a specific activity of>2 × 10^6 units/mg.
• Molecular Mass: 9.2 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MDGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant mouse Betacellulin (rmBetacellulin) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmBetacellulin remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50mM Tris, 300mM NaCl, pH9.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Btc betacellulin, epidermal growth factor family member [ Mus musculus ]
• Official Symbol: Btc
• Synonyms: BTC; betacellulin, epidermal growth factor family member; betacellulin; probetacellulin; Bcn
• Gene ID: 12223
• mRNA Refseq: NM_007568
• Protein Refseq: NP_031594
• UniProt ID: Q05928