Active Recombinant Mouse Btc Protein (81 aa)

Cat.No. : Btc-438B
Product Overview : Recombinant mouse Betacellulin (rmBetacellulin) produced in E. coli is a single non-glycosylated polypeptide chain containing 81 amino acids. A fully biologically active molecule, rmBetacellulin has a molecular mass of 9.2 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 81
Description : Betacellulin is a pleiotropic cytokine that belongs to the Epidermal Growth Factor (EGF) family. Like other members of the EGF family, Betacellulin possesses a conserved sequence of 35-40 amino acids which contain 3 disulfide bonds formed by 6 cysteines. Betacellulin is unique in the EGF family since it can bind and activate a broad spectrum of ErbB receptors. Functionally, Betacellulin plays a role in the development of the pancreas by activating signaling pathways beneficial for the function, survival and regeneration of pancreatic β-cells. Additionally, Betacellulin has potential angiogenic activities and is important for the growth, development and repair of certain tissues.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 ng/mL, measured by a cell proliferation assay using3T3cells, corresponding to a specific activity of>2 × 10^6 units/mg.
Molecular Mass : 9.2 kDa, observed by reducing SDS-PAGE.
AA Sequence : MDGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant mouse Betacellulin (rmBetacellulin) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmBetacellulin remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50mM Tris, 300mM NaCl, pH9.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Btc betacellulin, epidermal growth factor family member [ Mus musculus ]
Official Symbol Btc
Synonyms BTC; betacellulin, epidermal growth factor family member; betacellulin; probetacellulin; Bcn;
Gene ID 12223
mRNA Refseq NM_007568
Protein Refseq NP_031594
UniProt ID Q05928

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Btc Products

Required fields are marked with *

My Review for All Btc Products

Required fields are marked with *

0
cart-icon