Active Recombinant Human BTC Protein
| Cat.No. : | BTC-194B |
| Product Overview : | Recombinant Human BTC Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Description : | Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 4 pg/mL, measured in a cell proliferation assay using 3T3 cells. |
| Molecular Mass : | 15~18 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant Human Betacellulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Betacellulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | BTC betacellulin [ Homo sapiens ] |
| Official Symbol | BTC |
| Synonyms | BTC; betacellulin; probetacellulin; |
| Gene ID | 685 |
| mRNA Refseq | NM_001729 |
| Protein Refseq | NP_001720 |
| MIM | 600345 |
| UniProt ID | P35070 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *



