Active Recombinant Human BTC Protein

Species :	Human
Source :	HEK293
Description :	Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 4 pg/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass :	15~18 kDa, observed by reducing SDS-PAGE.
AA Sequence :	DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE.
Storage :	Lyophilized recombinant Human Betacellulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Betacellulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	BTC betacellulin [ Homo sapiens ]
Official Symbol	BTC
Synonyms	BTC; betacellulin; probetacellulin;
Gene ID	685
mRNA Refseq	NM_001729
Protein Refseq	NP_001720
MIM	600345
UniProt ID	P35070