Active Recombinant Human BTC Protein

• Cat.No.: BTC-194B
• Product Overview: Recombinant Human BTC Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 4 pg/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: 15~18 kDa, observed by reducing SDS-PAGE.
• AA Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Betacellulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Betacellulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: BTC betacellulin [ Homo sapiens ]
• Official Symbol: BTC
• Synonyms: BTC; betacellulin; probetacellulin
• Gene ID: 685
• mRNA Refseq: NM_001729
• Protein Refseq: NP_001720
• MIM: 600345
• UniProt ID: P35070