Active Recombinant Human BTC Protein
Cat.No. : | BTC-194B |
Product Overview : | Recombinant Human BTC Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 4 pg/mL, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | 15~18 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Betacellulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Betacellulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | BTC betacellulin [ Homo sapiens ] |
Official Symbol | BTC |
Synonyms | BTC; betacellulin; probetacellulin; |
Gene ID | 685 |
mRNA Refseq | NM_001729 |
Protein Refseq | NP_001720 |
MIM | 600345 |
UniProt ID | P35070 |
◆ Recombinant Proteins | ||
BTC-2604H | Recombinant Human BTC protein, GST-tagged | +Inquiry |
BTC-1665HF | Recombinant Full Length Human BTC Protein, GST-tagged | +Inquiry |
BTC-106H | Recombinant Human BTC Protein, Fc-tagged | +Inquiry |
Btc-330R | Recombinant Rat Btc Protein, His-tagged | +Inquiry |
BTC-3912Z | Recombinant Zebrafish BTC | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *
0
Inquiry Basket