Active Recombinant Mouse CCL3 Protein

Cat.No. : Ccl3-23M
Product Overview : Recombinant Mouse CCL3 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Macrophage inflammatory protein-1 alpha (MIP-1 α), also known as CCL3, is a cytokine produced by macrophages. MIP-1 α binds the chemokine receptors CCR1, CCR4 and CCR5 to induce inflammatory responses, including the recruitment of granulocytes and neutrophil superoxide production. The MIP-1 α and MIP-1 β heterodimer exhibits antiviral activity against the human immunodeficiency virus 1 (HIV-1).
Bio-activity : THP-1 chemotaxis, ≤100 ng/mL
Molecular Mass : Monomer, 7.9 kDa (69 aa)
AA Sequence : APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ]
Official Symbol Ccl3
Synonyms CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; TY-5; L2G25B; MIP1 (a); SIS-alpha; MIP-1 alpha; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; heparin-binding chemotaxis protein; macrophage inflammatory protein-1alpha; macrophage inflammatory protein 1-alpha; Mip1a; Scya3; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha;
Gene ID 20302
mRNA Refseq NM_011337
Protein Refseq NP_035467
UniProt ID Q5QNW0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl3 Products

Required fields are marked with *

My Review for All Ccl3 Products

Required fields are marked with *

0
cart-icon