Recombinant Rat Ccl3 protein
Cat.No. : | Ccl3-56R |
Product Overview : | Recombinant Rat Ccl3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 69 |
Description : | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human blood monocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
AA Sequence : | APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA |
Endotoxin : | Less than 0.1 EU/µg of rRtMIP-1α/CCL3 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl3 |
Official Symbol | Ccl3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; macrophage inflammatory protein 1-alpha; Macrophage inflammatory protein 1 alpha (Small inducible cytokine A3); Scya3; MIP-1a; |
Gene ID | 25542 |
mRNA Refseq | NM_013025 |
Protein Refseq | NP_037157 |
UniProt ID | P50229 |
◆ Recombinant Proteins | ||
CCL3-2949HF | Recombinant Full Length Human CCL3 Protein, GST-tagged | +Inquiry |
CCL3-2975M | Recombinant Mouse CCL3 Protein | +Inquiry |
CCL3-330C | Active Recombinant Human CCL3 Protein (70 aa) | +Inquiry |
CCL3-151H | Recombinant Human CCL3 Protein, His-tagged | +Inquiry |
CCL3-70H | Recombinant Human CCL3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl3 Products
Required fields are marked with *
My Review for All Ccl3 Products
Required fields are marked with *
0
Inquiry Basket