Active Recombinant Mouse Ccl4 Protein

Cat.No. : Ccl4-2038M
Product Overview : Purified recombinant protein of Mouse chemokine (C-C motif) ligand 4 (Ccl4) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Monokine with inflammatory and chemokinetic properties.
Bio-activity : Determined by its ability to chemoattract human monocytes using a concentration range of 20.0-100.0 ng/mL.
Molecular Mass : 7.8 kDa
AA Sequence : APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Ccl4 chemokine (C-C motif) ligand 4 [ Mus musculus (house mouse) ]
Official Symbol Ccl4
Synonyms Ccl4; chemokine (C-C motif) ligand 4; Mip; Scy; Act-; MIP-; Act-2; Mip1b; Scya4; AT744.; MIP-1B; AT744.1; C-C motif chemokine 4; ACT2; MIP-1-beta; SIS-gamma; immune activation protein 2; macrophage inflammatory protein 1-beta; small-inducible cytokine A4
Gene ID 20303
mRNA Refseq NM_013652
Protein Refseq NP_038680
UniProt ID P14097

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl4 Products

Required fields are marked with *

My Review for All Ccl4 Products

Required fields are marked with *

0
cart-icon