| Species : |
Mouse |
| Source : |
CHO |
| Description : |
Glial-Derived Neurotrophic Factor, also known as GDNF and ATF-1, is a neurotrophic factor belonging to the TGF-beta family. It is expressed in both central nervous system (CNS) and non-CNS tissues. GDNF signals through a receptor system composed of a RET and one of the four GFR alpha receptors. It promotes the survival and differentiation of dopaminergic neurons, and increases their high-affinity dopamine uptake. In a mouse Parkinson’s Disease model, GDNF has been shown to improve bradykinesia, rigidity, and postural instability. GDNF has also been shown to regulate kidney development, spermatogenesis and affect alcohol consumption. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 8μg/mL, measured in a bioassay using C6 cells. |
| Molecular Mass : |
17-22 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : |
Lyophilized recombinant murine GDNF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine GDNF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |