Active Recombinant Mouse Gdnf Protein

• Cat.No.: Gdnf-066M
• Product Overview: Purified recombinant protein of Mouse glial cell line derived neurotrophic factor (Gdnf) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Bio-activity: ED50 was determined by the proliferation of rat C6 cells is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
• Molecular Mass: 15 kDa
• AA Sequence: MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Gdnf glial cell line derived neurotrophic factor [ Mus musculus (house mouse) ]
• Official Symbol: Gdnf
• Synonyms: Gdnf; glial cell line derived neurotrophic factor; ATF; AI385739; glial cell line-derived neurotrophic factor; astrocyte-derived trophic factor; neurotrophic factor
• Gene ID: 14573
• mRNA Refseq: NM_010275
• Protein Refseq: NP_034405
• UniProt ID: P48540