Active Recombinant Mouse Gdnf Protein
| Cat.No. : | Gdnf-066M |
| Product Overview : | Purified recombinant protein of Mouse glial cell line derived neurotrophic factor (Gdnf) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Bio-activity : | ED50 was determined by the proliferation of rat C6 cells is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg. |
| Molecular Mass : | 15 kDa |
| AA Sequence : | MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
| Gene Name | Gdnf glial cell line derived neurotrophic factor [ Mus musculus (house mouse) ] |
| Official Symbol | Gdnf |
| Synonyms | Gdnf; glial cell line derived neurotrophic factor; ATF; AI385739; glial cell line-derived neurotrophic factor; astrocyte-derived trophic factor; neurotrophic factor |
| Gene ID | 14573 |
| mRNA Refseq | NM_010275 |
| Protein Refseq | NP_034405 |
| UniProt ID | P48540 |
| ◆ Cell & Tissue Lysates | ||
| GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
| GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gdnf Products
Required fields are marked with *
My Review for All Gdnf Products
Required fields are marked with *



