Active Recombinant Mouse IGF1 Protein

Cat.No. : Igf1-120M
Product Overview : Recombinant Mouse IGF1 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Insulin-like growth factor I (IGF-I) is a growth factor that is produced by the liver. IGF-1 production is stimulated by growth hormone (GH). IGF-I binds the insulin-like growth factor 1 receptor (IGF1R) and the insulin receptor to stimulate systemic body growth. IGF-I is one of the most potent activators of the AKT signaling pathway, which stimulates cell proliferation and inhibits programmed cell death.
Bio-activity : FDC-P1 cell proliferation, ≤20 ng/mL
Molecular Mass : Monomer, 7.7 kDa (70 aa)
AA Sequence : GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Igf1 insulin-like growth factor 1 [ Mus musculus (house mouse) ]
Official Symbol Igf1
Synonyms IGF1; insulin-like growth factor 1; insulin-like growth factor I; somatomedin; Igf-1; Igf-I; C730016P09Rik;
Gene ID 16000
mRNA Refseq NM_001111274
Protein Refseq NP_001104744
UniProt ID Q8CAR0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Igf1 Products

Required fields are marked with *

My Review for All Igf1 Products

Required fields are marked with *

0
cart-icon