| Species : |
Human |
| Source : |
E.coli |
| Description : |
IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple pr centigradeesses leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| AASequence : |
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA. |
| Molecular Mass : |
9.1 kDa |
| Bio-activity : |
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10 ng/mL, corresponding to a specific activity of 100,000 units/mg. |
| Purity : |
Greater than 98.0% as determined by SDS-PAGE. |
| Note : |
Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
| Storage : |
Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution the LR3 IGF1 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.2. |
| Solubility : |
It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100 μg/mL, which can then be further diluted to other aqueous solutions. |
| Shipping : |
Shipped at Room temperature. |
