Active Recombinant Mouse Il17a Protein
Cat.No. : | Il17a-093M |
Product Overview : | Purified recombinant protein of Mouse interleukin 17A (Il17a) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. |
Bio-activity : | Measured by its ability to induce IL-6 production by NIH 3T3 cells. |
Molecular Mass : | 30 kDa |
AA Sequence : | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il17a interleukin 17A [ Mus musculus (house mouse) ] |
Official Symbol | Il17a |
Synonyms | Il17a; interleukin 17A; Il17; Ctla8; IL-17; Ctla-8; IL-17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8 |
Gene ID | 16171 |
mRNA Refseq | NM_010552 |
Protein Refseq | NP_034682 |
UniProt ID | Q62386 |
◆ Recombinant Proteins | ||
IL17A-48H | Recombinant Human IL17A Protein | +Inquiry |
Il17a-680R | Active Recombinant Rat Il17a | +Inquiry |
Il17a-253I | Active Recombinant Mouse Il17a Protein (133 aa) | +Inquiry |
Il17a-180M | Recombinant Mouse interleukin 17A Protein, Flag tagged | +Inquiry |
IL17A-903HFL | Recombinant Full Length Human IL17A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il17a Products
Required fields are marked with *
My Review for All Il17a Products
Required fields are marked with *
0
Inquiry Basket