Active Recombinant Mouse Il17a Protein

Cat.No. : Il17a-093M
Product Overview : Purified recombinant protein of Mouse interleukin 17A (Il17a) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.
Bio-activity : Measured by its ability to induce IL-6 production by NIH 3T3 cells.
Molecular Mass : 30 kDa
AA Sequence : AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il17a interleukin 17A [ Mus musculus (house mouse) ]
Official Symbol Il17a
Synonyms Il17a; interleukin 17A; Il17; Ctla8; IL-17; Ctla-8; IL-17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8
Gene ID 16171
mRNA Refseq NM_010552
Protein Refseq NP_034682
UniProt ID Q62386

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il17a Products

Required fields are marked with *

My Review for All Il17a Products

Required fields are marked with *

0
cart-icon