Active Recombinant Mouse Il17b Protein, His-Tagged
Cat.No. : | Il17b-01M |
Product Overview : | Recombinant mouse Il17b Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. L17B Diseases associated with IL17B include spondyloarthropathy and neuronitis, and among its related super-pathways are Mucin expression in CF via IL-6, IL-17 signaling pathways, and STAT3 Pathway. |
Form : | Lyophilized powder |
AA Sequence : | MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHD PSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il17b interleukin 17b [ Mus musculus (house mouse) ] |
Official Symbol | Il17b |
Synonyms | Zcyto7; 1110006O16Rik; 1700006N07Rik |
Gene ID | 56069 |
mRNA Refseq | NM_019508.1 |
Protein Refseq | NP_062381.1 |
UniProt ID | Q9CTI4 |
◆ Recombinant Proteins | ||
Il17b-1821R | Recombinant Rat Il17b protein, His-tagged | +Inquiry |
IL17B-29741TH | Recombinant Human IL17B protein | +Inquiry |
IL17B-942H | Recombinant Human IL17B Protein, His-tagged | +Inquiry |
IL17B-316H | Active Recombinant Human interleukin 17B, HIgG1 Fc-tagged, mutant | +Inquiry |
Il17b-440M | Recombinant Mouse Il17b protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17B-5244HCL | Recombinant Human IL17B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il17b Products
Required fields are marked with *
My Review for All Il17b Products
Required fields are marked with *
0
Inquiry Basket