Active Recombinant Mouse Il17b Protein, His-Tagged

Cat.No. : Il17b-01M
Product Overview : Recombinant mouse Il17b Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : The interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. L17B Diseases associated with IL17B include spondyloarthropathy and neuronitis, and among its related super-pathways are Mucin expression in CF via IL-6, IL-17 signaling pathways, and STAT3 Pathway.
Form : Lyophilized powder
AA Sequence : MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHD
PSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il17b interleukin 17b [ Mus musculus (house mouse) ]
Official Symbol Il17b
Synonyms Zcyto7; 1110006O16Rik; 1700006N07Rik
Gene ID 56069
mRNA Refseq NM_019508.1
Protein Refseq NP_062381.1
UniProt ID Q9CTI4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il17b Products

Required fields are marked with *

My Review for All Il17b Products

Required fields are marked with *

0
cart-icon