Recombinant Human IL17B protein

Cat.No. : IL17B-29741TH
Product Overview : Recombinant Human IL17B protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 161
Description : The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. Alternative splicing results in multiple splice variants.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.1 % Tween-20 and 3 % Trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion of human HepG2 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
Molecular Mass : Approximately 36.5 kDa, a non-disulfide-linked homodimer of two 161 amino acid polypeptide chains.
AA Sequence : MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Endotoxin : Less than 0.1 EU/µg of rHuIL-17B as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL17B
Official Symbol IL17B
Synonyms IL17B; interleukin 17B; interleukin-17B; IL 17B; IL 20; MGC138900; MGC138901; neuronal interleukin 17 related factor; NIRF; ZCYTO7; interleukin 20; interleukin-20; cytokine Zcyto7; interleukin-17 beta; cytokine-like protein ZCYTO7; neuronal interleukin-17 related factor; neuronal interleukin-17-related factor; IL-20; IL-17B;
Gene ID 27190
mRNA Refseq NM_014443
Protein Refseq NP_055258
MIM 604627
UniProt ID Q9UHF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17B Products

Required fields are marked with *

My Review for All IL17B Products

Required fields are marked with *

0
cart-icon
0
compare icon