Recombinant Human IL17B protein
Cat.No. : | IL17B-29741TH |
Product Overview : | Recombinant Human IL17B protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 161 |
Description : | The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. Alternative splicing results in multiple splice variants. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.1 % Tween-20 and 3 % Trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion of human HepG2 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
Molecular Mass : | Approximately 36.5 kDa, a non-disulfide-linked homodimer of two 161 amino acid polypeptide chains. |
AA Sequence : | MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
Endotoxin : | Less than 0.1 EU/µg of rHuIL-17B as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL17B |
Official Symbol | IL17B |
Synonyms | IL17B; interleukin 17B; interleukin-17B; IL 17B; IL 20; MGC138900; MGC138901; neuronal interleukin 17 related factor; NIRF; ZCYTO7; interleukin 20; interleukin-20; cytokine Zcyto7; interleukin-17 beta; cytokine-like protein ZCYTO7; neuronal interleukin-17 related factor; neuronal interleukin-17-related factor; IL-20; IL-17B; |
Gene ID | 27190 |
mRNA Refseq | NM_014443 |
Protein Refseq | NP_055258 |
MIM | 604627 |
UniProt ID | Q9UHF5 |
◆ Recombinant Proteins | ||
Il17b-289M | Recombinant Mouse Interleukin 17B, His-tagged | +Inquiry |
IL17B-562H | Recombinant Human interleukin 17B, His-tagged | +Inquiry |
IL17B-315H | Active Recombinant Human interleukin 17B, MIgG2a Fc-tagged | +Inquiry |
IL17B-942H | Recombinant Human IL17B Protein, His-tagged | +Inquiry |
IL17B-4495M | Recombinant Mouse IL17B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17B-5244HCL | Recombinant Human IL17B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17B Products
Required fields are marked with *
My Review for All IL17B Products
Required fields are marked with *