Active Recombinant Mouse Il1a Protein

Cat.No. : Il1a-097M
Product Overview : Purified recombinant protein of Mouse interleukin 1 alpha (Il1a) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Bio-activity : The ED50 as determined by the dose-dependent stimulation of murine D10S cells is > 0.002 ng/ml, corresponding to a specific activity of > 5 x 10^8 units/mg.
Molecular Mass : 17.9 kDa
AA Sequence : SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il1a interleukin 1 alpha [ Mus musculus (house mouse) ]
Official Symbol Il1a
Synonyms Il1a; interleukin 1 alpha; Il-1a; interleukin-1 alpha; IL-1 alpha
Gene ID 16175
mRNA Refseq NM_010554
Protein Refseq NP_034684
UniProt ID P01582

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1a Products

Required fields are marked with *

My Review for All Il1a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon