Active Recombinant Mouse Il1a Protein

• Cat.No.: Il1a-097M
• Product Overview: Purified recombinant protein of Mouse interleukin 1 alpha (Il1a) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of murine D10S cells is > 0.002 ng/ml, corresponding to a specific activity of > 5 x 10^8 units/mg.
• Molecular Mass: 17.9 kDa
• AA Sequence: SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il1a interleukin 1 alpha [ Mus musculus (house mouse) ]
• Official Symbol: Il1a
• Synonyms: Il1a; interleukin 1 alpha; Il-1a; interleukin-1 alpha; IL-1 alpha
• Gene ID: 16175
• mRNA Refseq: NM_010554
• Protein Refseq: NP_034684
• UniProt ID: P01582