Active Recombinant Mouse Il1a Protein
Cat.No. : | Il1a-097M |
Product Overview : | Purified recombinant protein of Mouse interleukin 1 alpha (Il1a) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
Bio-activity : | The ED50 as determined by the dose-dependent stimulation of murine D10S cells is > 0.002 ng/ml, corresponding to a specific activity of > 5 x 10^8 units/mg. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il1a interleukin 1 alpha [ Mus musculus (house mouse) ] |
Official Symbol | Il1a |
Synonyms | Il1a; interleukin 1 alpha; Il-1a; interleukin-1 alpha; IL-1 alpha |
Gene ID | 16175 |
mRNA Refseq | NM_010554 |
Protein Refseq | NP_034684 |
UniProt ID | P01582 |
◆ Recombinant Proteins | ||
IL1A-1399H | Recombinant Human IL1A protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
IL1A-2687R | Recombinant Rat IL1A Protein, His (Fc)-Avi-tagged | +Inquiry |
IL1A-625H | Recombinant Human IL1A protein, His & T7-tagged | +Inquiry |
Il1a-306M | Active Recombinant Mouse Il1a protein | +Inquiry |
IL1A-134H | Recombinant Human Interleukin 1, Alpha, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il1a Products
Required fields are marked with *
My Review for All Il1a Products
Required fields are marked with *
0
Inquiry Basket