| Species : |
Rhesus macaque |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
159 |
| Description : |
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
| Form : |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/ml, corresponding to a specific activity of > 1.0 × 10⁸ IU/mg. |
| Molecular Mass : |
Approximately 18.1 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids. |
| AA Sequence : |
SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA |
| Endotoxin : |
Less than 0.1 EU/µg of rRhIL-1α as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analyses. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |