Active Recombinant Mouse IL22 Protein

Cat.No. : IL22-164M
Product Overview : Recombinant Mouse IL22 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10RB chains. IL-22 is a potent mediator of cellular inflammatory responses and wound healing.
Bio-activity : Production of IL-10 from human COLO-205 cells, < 1 ng/mL
Molecular Mass : Monomer, 16.8 kDa (147 aa)
AA Sequence : MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Endotoxin : < 1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Il22 interleukin 22 [ Mus musculus (house mouse) ]
Official Symbol IL22
Synonyms IL22; interleukin 22; interleukin-22; ILTIF alpha; IL-TIF alpha; interleukin-22a; IL-10-related T-cell-derived-inducible factor; interleukin 10-related T cell-derived inducible factor; IL-22; Iltif; IL-22a; ILTIFa; MGC129416; MGC129417;
Gene ID 50929
mRNA Refseq NM_016971
Protein Refseq NP_058667
UniProt ID Q9JJY9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL22 Products

Required fields are marked with *

My Review for All IL22 Products

Required fields are marked with *

0
cart-icon