Active Recombinant Mouse Il3 Protein (135 aa)
Cat.No. : | Il3-357I |
Product Overview : | Recombinant mouse Interleukin-3 (rmIL-3) produced in E. coli is a single non-glycosylated polypeptide chain containing of 135 amino acids. A fully biologically active molecule, rmIL-3 has a molecular mass of 15.2 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 135 |
Description : | Interleukin-3 (IL-3) is a pleiotropic cytokine belonging to the interleukin family. IL-3 shares similarities with Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) and IL-5: they all have a four-helix bundle structure, are located on the same chromosomes in both human and mouse, are produced by activated T cells, and share receptors. The IL-3/IL-5/GM-CSF receptor family members are all heterodimeric, composed of a receptor-specific α chain and a common β chain. IL-3 is also called multi-colony stimulating factor since it stimulates the development and colony formation of multiple lineages of hematopoietic cells by activating intracellular pathways such as Ras-Raf-ERK and JAK/STAT. IL-3 inhibits apoptosis and promotes cell survival by targeting the anti-apoptotic bcl-2 gene family. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.05 ng/mL, measured by a cell proliferation assay using M-NFS-60 cells, corresponding to a specific activity of > 2 × 10^7 units/mg. |
Molecular Mass : | 15.2 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant mouse Interleukin-3 (rmIL-3) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-3 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Il3 interleukin 3 [ Mus musculus ] |
Official Symbol | Il3 |
Synonyms | IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu; |
Gene ID | 16187 |
mRNA Refseq | NM_010556 |
Protein Refseq | NP_034686 |
UniProt ID | P01586 |
◆ Recombinant Proteins | ||
Il3-188M | Recombinant Active Mouse IL3 Protein, His-tagged(C-ter) | +Inquiry |
IL3-097I | Active Recombinant Human IL3 Protein (133 aa) | +Inquiry |
IL3-6745H | Recombinant Human IL3 protein, hFc-tagged | +Inquiry |
Il3-576R | Recombinant Rat Il3 protein | +Inquiry |
IL3-4369B | Recombinant Bovine IL3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *
0
Inquiry Basket