Active Recombinant Mouse IL3 Protein

Cat.No. : IL3-169M
Product Overview : Recombinant Mouse IL3 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Interleukin 3 (IL-3) is a cytokine that is produced by activated T cells and mast cells. IL-3 induces the differentiation of hematopoietic stem cells into myeloid precursor cells, such as erythrocyte, megakaryocyte, granulocyte, monocyte, and dendritic cells. IL-3 also functions in the nervous system and is important during the B-1 cell regulation of chronic inflammatory diseases.
Bio-activity : M-NFS-60 cell proliferation, ≤250 pg/mL
Molecular Mass : Monomer, 15.2 kDa (135 aa)
AA Sequence : MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Il3 interleukin 3 [ Mus musculus (house mouse) ]
Official Symbol IL3
Synonyms IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu;
Gene ID 16187
mRNA Refseq NM_010556
Protein Refseq NP_034686
UniProt ID P01586

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL3 Products

Required fields are marked with *

My Review for All IL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon