Recombinant Rhesus IL3 protein
Cat.No. : | IL3-539R |
Product Overview : | Recombinant Rhesus IL3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 124 |
Description : | Interleukin-3 (IL-3) is an interleukin, a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. The rhesus macaque IL-3 reported to be a monomer, as it is known, contains 124 amino acids residues which is a single non-glycosylated polypeptide. Specifically, recombinant rhesus macaque, human and murine IL-3 share low homology. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 5 % trehalose. |
Bio-activity : | Assay #1: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2 × 10⁵ IU/mg. Assay #2: The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 14.0 kDa, a single non-glycosylated polypeptide chain containing 124 amino acids. |
AA Sequence : | APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ |
Endotoxin : | Less than 1 EU/µg of rRhIL-3 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL3 |
Official Symbol | IL3 |
Synonyms | Hematopoietic Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor |
Gene ID | 706946 |
mRNA Refseq | NM_001101734.1 |
Protein Refseq | NP_001095204.1 |
UniProt ID | P25140 |
◆ Recombinant Proteins | ||
IL3-1556H | Recombinant human IL3, Active, His-tagged | +Inquiry |
Il3-58M | Active Recombinant Mouse Il3 Protein (Asp33-Cys166), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL3-503H | Active Recombinant Human IL3 | +Inquiry |
Il3-640M | Recombinant Mouse Il3 protein, His & T7-tagged | +Inquiry |
Il3-108M | Active Recombinant Mouse Il3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *
0
Inquiry Basket