Active Recombinant Mouse IL5 Protein
Cat.No. : | IL5-183M |
Product Overview : | Recombinant Mouse IL5 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 5 (IL-5) is a hematopoietic growth factor that is expressed in type 2 T helper (Th2) cells, mast cells, and eosinophils. IL-5 acts through the IL-5 receptor (IL-5R), stimulates B cell growth, and mediates eosinophil activation. IL-5 expression is regulated by the GATA binding protein 3 (GATA3) transcription factor. Human and mouse IL-5 show cross-reactivity. |
Bio-activity : | TF-1 cell proliferation, ≤2 ng/mL |
Molecular Mass : | Dimer, 13.1/26.3 kDa (113/226 aa) |
AA Sequence : | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Il5 interleukin 5 [ Mus musculus (house mouse) ] |
Official Symbol | IL5 |
Synonyms | IL5; interleukin 5; interleukin-5; TRF; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Il-5; |
Gene ID | 16191 |
mRNA Refseq | NM_010558 |
Protein Refseq | NP_034688 |
UniProt ID | P04401 |
◆ Recombinant Proteins | ||
Il5-2095R | Recombinant Rat Il5 protein | +Inquiry |
IL5-5450H | Recombinant Human IL5 protein, His-tagged | +Inquiry |
IL5-76H | Recombinant Human IL5 Protein, His-tagged | +Inquiry |
IL5-61H | Recombinant Human IL5 protein | +Inquiry |
IL5-8864H | Active Recombinant Human IL5,His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL5 Products
Required fields are marked with *
My Review for All IL5 Products
Required fields are marked with *
0
Inquiry Basket