Active Recombinant Mouse Il5 Protein, His-tagged
Cat.No. : | Il5-08M |
Product Overview : | Recombinant mouse IL-5 (21-133aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 21-133aa |
Description : | Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 range ≤ 1 ng/mL. |
Molecular Mass : | 13.9kDa (119aa) |
AA Sequence : | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | Il5 interleukin 5 [ Mus musculus (house mouse) ] |
Official Symbol | Il5 |
Synonyms | Il5; interleukin 5; Il; Il-5; interleukin-5; B-cell growth factor II; BCGF-II; T-cell replacing factor; TRF; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor |
Gene ID | 16191 |
mRNA Refseq | NM_010558 |
Protein Refseq | NP_034688 |
UniProt ID | P04401 |
◆ Recombinant Proteins | ||
Il5-224M | Recombinant Mouse Interleukin 5 | +Inquiry |
IL5-652P | Recombinant Pig IL5 protein, His & T7-tagged | +Inquiry |
Il5-112M | Active Recombinant Mouse Il5 Protein | +Inquiry |
Il5-1680M | Recombinant Mouse Il5 Protein, His-tagged | +Inquiry |
IL5-185H | Recombinant Human IL5, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il5 Products
Required fields are marked with *
My Review for All Il5 Products
Required fields are marked with *