| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Molecular Weight : |
14.9 kDa |
| AA Sequence : |
ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
| Bio-Activity : |
The ED50 was determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is less than 0.2 ng/mL, corresponding to a specific activity of >5.0×10^6 IU/mg. |
| Purity : |
Greater than 96.0% as determined by: (a) Analysis by RP-HPLC; (b) Analysis by SDS-PAGE. |
| Notes : |
Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
| Solubility : |
It is recommended to reconstitute the lyophilized Interleukin 7 in sterile 18 MΩ-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions. |
| Stability : |
Lyophilized Interleukin-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution IL7 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles. |
| Storage Buffer : |
Filtered (0.2μm) and lyophilized from a concentrated (1 mg/mL) solution in 1×PBS, pH7.4 and 2% trehalose. |
| Reference : |
1. Disruption of Bis Leads to the Deterioration of the Vascular Niche for Hematopoietic Stem Cells. Publication: Stem Cells 28.2 (2010): 268-278. |