Active Recombinant Human IL7 Protein, His-tagged

Species :	Human
Source :	CHO
Tag :	His
Description :	Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor. IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 0.2ng/mL, measured in a cell proliferation assay using 2E8 cells.
Molecular Mass :	24-34 kDa, observed by reducing SDS-PAGE.
AA Sequence :	DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE.
Storage :	Lyophilized recombinant human Interleukin-7 (IL-7), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Interleukin-7 (IL-7), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	IL7 interleukin 7 [ Homo sapiens ]
Official Symbol	IL7
Synonyms	IL7; interleukin 7; interleukin-7; IL 7; IL-7;
Gene ID	3574
mRNA Refseq	NM_000880
Protein Refseq	NP_000871
MIM	146660
UniProt ID	P13232