Active Recombinant Mouse Kitl Protein
Cat.No. : | Kitl-198M |
Product Overview : | Recombinant Mouse Kitl Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Stem cell factor (SCF) is a cytokine made by fibroblasts and endothelial cells. SCF binds to the receptor c-Kit/CD117 and plays a critical role in the maintenance, survival, and differentiation of hematopoietic stem cells. While human SCF shows no activity on murine cells, murine and rat SCF are active on human cells. |
Bio-activity : | TF-1 cell proliferation, ≤20 ng/mL |
Molecular Mass : | Monomer, 18.4 kDa (165 aa) |
AA Sequence : | MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM sodium phosphate, pH 6.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Kitl kit ligand [ Mus musculus (house mouse) ] |
Official Symbol | Kitl |
Synonyms | KITL; kit ligand; cloud gray; C-kit ligand; Steel factor; grizzle-belly; stem cell factor; mast cell growth factor; hematopoietic growth factor KL; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; Kitlg; contrasted; |
Gene ID | 17311 |
mRNA Refseq | NM_013598 |
Protein Refseq | NP_038626 |
UniProt ID | P20826 |
◆ Recombinant Proteins | ||
KITLG-22H | Active Recombinant Human KITLG, MIgG2a Fc-tagged | +Inquiry |
KITLG-21H | Active Recombinant Human KITLG, HIgG1 Fc-tagged, mutant | +Inquiry |
KITLG-4356R | Recombinant Rabbit KITLG Protein | +Inquiry |
KITLG-33H | Active Recombinant Human KITLG, His-tagged | +Inquiry |
Kitlg-200R | Recombinant Rat Kitlg Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kitlg Products
Required fields are marked with *
My Review for All Kitlg Products
Required fields are marked with *