Recombinant Rat Kitlg Protein
Cat.No. : | Kitlg-200R |
Product Overview : | Recombinant Rat Kitlg Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Stem cell factor (SCF) is a cytokine made by fibroblasts and endothelial cells. SCF binds to the receptor c-Kit/CD117 and plays a critical role in the maintenance, survival, and differentiation of hematopoietic stem cells. Human SCF shows no activity on murine cells, but murine and rat SCF are active on human cells. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 18.5 kDa (165 aa) |
AA Sequence : | MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile 10 mM HCl at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Kitlg KIT ligand [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Kitlg |
Synonyms | KITLG; KIT ligand; kit ligand; C-kit ligand; stem cell factor KL-1; mast cell growth factor; steel factor/kit ligand; hematopoietic growth factor KL; Mgf; SCF; Kitl; |
Gene ID | 60427 |
mRNA Refseq | NM_021843 |
Protein Refseq | NP_068615 |
UniProt ID | P21581 |
◆ Recombinant Proteins | ||
Kitl-1243M | Recombinant Mouse Kit Ligand, His-tagged | +Inquiry |
KITLG-450P | Recombinant Pig KITLG protein, His-tagged | +Inquiry |
Kitlg-164K | Active Recombinant Rat Kitlg Protein | +Inquiry |
KITLG-2585H | Recombinant Human KITLG Protein (Glu26-Ala189), N-His tagged | +Inquiry |
KITLG-306H | Active Recombinant Human KIT Ligand | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kitlg Products
Required fields are marked with *
My Review for All Kitlg Products
Required fields are marked with *