Recombinant Rat Kitlg Protein

Cat.No. : Kitlg-200R
Product Overview : Recombinant Rat Kitlg Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Stem cell factor (SCF) is a cytokine made by fibroblasts and endothelial cells. SCF binds to the receptor c-Kit/CD117 and plays a critical role in the maintenance, survival, and differentiation of hematopoietic stem cells. Human SCF shows no activity on murine cells, but murine and rat SCF are active on human cells.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 18.5 kDa (165 aa)
AA Sequence : MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile 10 mM HCl at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Kitlg KIT ligand [ Rattus norvegicus (Norway rat) ]
Official Symbol Kitlg
Synonyms KITLG; KIT ligand; kit ligand; C-kit ligand; stem cell factor KL-1; mast cell growth factor; steel factor/kit ligand; hematopoietic growth factor KL; Mgf; SCF; Kitl;
Gene ID 60427
mRNA Refseq NM_021843
Protein Refseq NP_068615
UniProt ID P21581

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Kitlg Products

Required fields are marked with *

My Review for All Kitlg Products

Required fields are marked with *

0
cart-icon