Species : |
Mouse |
Source : |
E.coli |
Description : |
Biased expression in subcutaneous fat pad adult (RPKM 267.7), genital fat pad adult (RPKM 183.5) and 1 other tissue. |
Bio-activity : |
PeproTech's murine Leptin has been shown to be biologically active in two different mouse obesity models, ob/ob and NZO. Both strains of mice were treated via intraperitoneal injection once daily at a dose of 5 ug Leptin/gm of body weight for 14 days. Significant effects on body weight , food consumption, and plasma glucose levels were observed to saline-treated controls |
Molecular Mass : |
16.2 kDa |
AA Sequence : |
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
Endotoxin : |
Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : |
>95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : |
Store at -80 centigrade. |
Storage Buffer : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : |
Resuspend the protein in the desired concentration in proper buffer. |