Active Recombinant Mouse Lep Protein

• Cat.No.: Lep-120M
• Product Overview: Purified recombinant protein of Mouse leptin (Lep) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Biased expression in subcutaneous fat pad adult (RPKM 267.7), genital fat pad adult (RPKM 183.5) and 1 other tissue.
• Bio-activity: PeproTech's murine Leptin has been shown to be biologically active in two different mouse obesity models, ob/ob and NZO. Both strains of mice were treated via intraperitoneal injection once daily at a dose of 5 ug Leptin/gm of body weight for 14 days. Significant effects on body weight , food consumption, and plasma glucose levels were observed to saline-treated controls
• Molecular Mass: 16.2 kDa
• AA Sequence: MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Lep leptin [ Mus musculus (house mouse) ]
• Official Symbol: Lep
• Synonyms: Lep; leptin; ob; obese; leptin; obesity factor
• Gene ID: 16846
• mRNA Refseq: NM_008493
• Protein Refseq: NP_032519
• UniProt ID: P41160