Active Recombinant Mouse Lep Protein
Cat.No. : | Lep-120M |
Product Overview : | Purified recombinant protein of Mouse leptin (Lep) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Biased expression in subcutaneous fat pad adult (RPKM 267.7), genital fat pad adult (RPKM 183.5) and 1 other tissue. |
Bio-activity : | PeproTech's murine Leptin has been shown to be biologically active in two different mouse obesity models, ob/ob and NZO. Both strains of mice were treated via intraperitoneal injection once daily at a dose of 5 ug Leptin/gm of body weight for 14 days. Significant effects on body weight , food consumption, and plasma glucose levels were observed to saline-treated controls |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Lep leptin [ Mus musculus (house mouse) ] |
Official Symbol | Lep |
Synonyms | Lep; leptin; ob; obese; leptin; obesity factor |
Gene ID | 16846 |
mRNA Refseq | NM_008493 |
Protein Refseq | NP_032519 |
UniProt ID | P41160 |
◆ Recombinant Proteins | ||
LEP-4433H | Recombinant Human LEP Protein (Val22-Cys167), N-His tagged | +Inquiry |
Lep-202M | Recombinant Mouse Lep Protein | +Inquiry |
LEP-24P | Recombinant Porcine Leptin | +Inquiry |
LEP-264O | Active Recombinant Ovine Leptin Antagonist Triple Mutant, PEG-tagged | +Inquiry |
LEP-675H | Recombinant Human LEP protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
LEP-27641TH | Native Human LEP | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEP-4773HCL | Recombinant Human LEP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lep Products
Required fields are marked with *
My Review for All Lep Products
Required fields are marked with *
0
Inquiry Basket