Active Recombinant Mouse Lep Protein

Cat.No. : Lep-120M
Product Overview : Purified recombinant protein of Mouse leptin (Lep) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Biased expression in subcutaneous fat pad adult (RPKM 267.7), genital fat pad adult (RPKM 183.5) and 1 other tissue.
Bio-activity : PeproTech's murine Leptin has been shown to be biologically active in two different mouse obesity models, ob/ob and NZO. Both strains of mice were treated via intraperitoneal injection once daily at a dose of 5 ug Leptin/gm of body weight for 14 days. Significant effects on body weight , food consumption, and plasma glucose levels were observed to saline-treated controls
Molecular Mass : 16.2 kDa
AA Sequence : MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Lep leptin [ Mus musculus (house mouse) ]
Official Symbol Lep
Synonyms Lep; leptin; ob; obese; leptin; obesity factor
Gene ID 16846
mRNA Refseq NM_008493
Protein Refseq NP_032519
UniProt ID P41160

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lep Products

Required fields are marked with *

My Review for All Lep Products

Required fields are marked with *

0
cart-icon