Recombinant Rhesus Macaque LEP Protein, His-tagged
| Cat.No. : | LEP-2496R |
| Product Overview : | Recombinant Rhesus Macaque LEP Protein (22-167 aa) with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus Macaque |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 22-167 aa |
| Description : | This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Form : | Sterile PBS, pH7.4, 0.2%SKL |
| Molecular Mass : | 17 kDa |
| AASequence : | VPIQKVQSDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLTLSQMDQTLAIYQQILINLPSRNVIQISNDLENLRDLLHLLAFSKSCHLPLASGLETLESLGDVLEASLYSTEVVALSRLQGSLQDMLWQLDLSPGCHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 85% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | PTPN22 protein tyrosine phosphatase non-receptor type 22 [ Homo sapiens (human) ] |
| Official Symbol | LEP |
| Synonyms | PTPN22; protein tyrosine phosphatase non-receptor type 22; LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6; tyrosine-protein phosphatase non-receptor type 22; PEST-domain phosphatase; hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; lymphoid-specific protein tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 22 (lymphoid); protein tyrosine phosphatase, non-receptor type 8; EC 3.1.3.48 |
| Gene ID | 26191 |
| mRNA Refseq | NM_015967 |
| Protein Refseq | NP_057051 |
| MIM | 600716 |
| UniProt ID | Q9Y2R2 |
| ◆ Recombinant Proteins | ||
| Lep-261M | Recombinant Mouse Leptin Antagonist Triple Mutant | +Inquiry |
| LEP-3376R | Recombinant Rat LEP Protein | +Inquiry |
| LEP-1088P | Recombinant Pig LEP Protein, His-tagged | +Inquiry |
| LEP-07C | Recombinant Chicken Leptin | +Inquiry |
| LEP-25R | Recombinant Rabbit Leptin | +Inquiry |
| ◆ Native Proteins | ||
| LEP-27641TH | Native Human LEP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LEP-4773HCL | Recombinant Human LEP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEP Products
Required fields are marked with *
My Review for All LEP Products
Required fields are marked with *



