Recombinant Rhesus Macaque LEP Protein, His-tagged

• Cat.No.: LEP-2496R
• Product Overview: Recombinant Rhesus Macaque LEP Protein (22-167 aa) with His tag was expressed in HEK293.

Specification

• Species: Rhesus Macaque
• Source: HEK293
• Tag: His
• Protein Length: 22-167 aa
• Description: This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.
• Form: Sterile PBS, pH7.4, 0.2%SKL
• Molecular Mass: 17 kDa
• AASequence: VPIQKVQSDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLTLSQMDQTLAIYQQILINLPSRNVIQISNDLENLRDLLHLLAFSKSCHLPLASGLETLESLGDVLEASLYSTEVVALSRLQGSLQDMLWQLDLSPGCHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: PTPN22 protein tyrosine phosphatase non-receptor type 22 [ Homo sapiens (human) ]
• Official Symbol: LEP
• Synonyms: PTPN22; protein tyrosine phosphatase non-receptor type 22; LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6; tyrosine-protein phosphatase non-receptor type 22; PEST-domain phosphatase; hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; lymphoid-specific protein tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 22 (lymphoid); protein tyrosine phosphatase, non-receptor type 8; EC 3.1.3.48
• Gene ID: 26191
• mRNA Refseq: NM_015967
• Protein Refseq: NP_057051
• MIM: 600716
• UniProt ID: Q9Y2R2