Active Recombinant Mouse Lgals3 Protein, His-tagged
Cat.No. : | Lgals3-7258M |
Product Overview : | Recombinant Mouse Lgals3 protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-264 |
Description : | Biased expression in colon adult (RPKM 931.1), duodenum adult (RPKM 311.5) and 8 other tissues. |
Form : | Liquid |
Bio-activity : | The ED50 for this effect is equal or higher than 25 μg/mL. Measured by its ability to agglutinate human red blood cells. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 50 % glycerol,1 mM DTT, 2 mM EDTA. |
Gene Name | Lgals3 lectin, galactose binding, soluble 3 [ Mus musculus (house mouse) ] |
Official Symbol | Lgals3 |
Synonyms | Lgals3; lectin, galactose binding, soluble 3; ga; GBP; L-3; L-34; Mac-; gal3; Mac-2; galect; galectin-3; 35 kDa lectin; CBP 35; L-34 galactoside-binding lectin; carbohydrate-binding protein 35; gal-3; galactose-specific lectin 3; igE-binding protein; laminin-binding protein; lectin L-29; mac-2 antigen |
Gene ID | 16854 |
mRNA Refseq | NM_001145953 |
Protein Refseq | NP_001139425 |
UniProt ID | Q8C253 |
◆ Recombinant Proteins | ||
LGALS3-1319H | Recombinant Human LGALS3 protein, His-tagged | +Inquiry |
LGALS3-4952H | Recombinant Human LGALS3 protein | +Inquiry |
LGALS3-205H | Recombinant Human LGALS3 Protein | +Inquiry |
LGALS3-12H | Recombinant Human LGALS3, MYC/DDK-tagged | +Inquiry |
LGALS3-191H | Active Recombinant Human LGALS3 Protein (Ala2-Ile250), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Native Proteins | ||
LGALS3-6914H | Active Recombinant Human LGALS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgals3 Products
Required fields are marked with *
My Review for All Lgals3 Products
Required fields are marked with *
0
Inquiry Basket