Active Recombinant Human LGALS3 Protein, His tagged

• Cat.No.: LGALS3-6914H
• Product Overview: Recombinant Galectin-3 protein (1-250 aa) with His tag was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-250 aa
• Description: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
• Form: Liquid
• Bio-activity: The ED50 for this effect is less or equal to 15 μg/mL. Measured by its ability to agglutinate human red blood cells.
• Molecular Mass: 28.3 kDa
• AA Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Reference: 1. Barondes SH., et al. (1994) J Biol Chem. 269(33):20807-10. 2. Kadrofske MM., et al. (1998) Arch Biochem Biophys. 349(1):7-20.

Gene Information

• Gene Name: LGALS3 lectin, galactoside-binding, soluble, 3 [ Homo sapiens (human) ]
• Official Symbol: LGALS3
• Synonyms: LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP
• Gene ID: 3958
• mRNA Refseq: NM_002306
• Protein Refseq: NP_002297
• MIM: 153619
• UniProt ID: P17931