| Species : |
Human |
| Source : |
E. coli |
| Tag : |
His |
| Protein Length : |
1-250 aa |
| Description : |
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. |
| Form : |
Liquid |
| Bio-activity : |
The ED50 for this effect is less or equal to 15 μg/mL. Measured by its ability to agglutinate human red blood cells. |
| Molecular Mass : |
28.3 kDa |
| AA Sequence : |
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Note : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
| Reference : |
1. Barondes SH., et al. (1994) J Biol Chem. 269(33):20807-10.
2. Kadrofske MM., et al. (1998) Arch Biochem Biophys. 349(1):7-20. |
