Active Recombinant Human LGALS3 Protein, His tagged

Cat.No. : LGALS3-6914H
Product Overview : Recombinant Galectin-3 protein (1-250 aa) with His tag was expressed in E. coli and purified by using conventional chromatography techniques.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 1-250 aa
Description : This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
Form : Liquid
Bio-activity : The ED50 for this effect is less or equal to 15 μg/mL. Measured by its ability to agglutinate human red blood cells.
Molecular Mass : 28.3 kDa
AA Sequence : MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Note : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl
Concentration : 0.5 mg/mL (determined by Bradford assay)
Reference : 1. Barondes SH., et al. (1994) J Biol Chem. 269(33):20807-10. 2. Kadrofske MM., et al. (1998) Arch Biochem Biophys. 349(1):7-20.
Gene Name LGALS3 lectin, galactoside-binding, soluble, 3 [ Homo sapiens (human) ]
Official Symbol LGALS3
Synonyms LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP
Gene ID 3958
mRNA Refseq NM_002306
Protein Refseq NP_002297
MIM 153619
UniProt ID P17931

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LGALS3 Products

Required fields are marked with *

My Review for All LGALS3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon