Active Recombinant Mouse Lif Protein (180 aa)

Cat.No. : Lif-340L
Product Overview : Recombinant mouse Leukemia Inhibitory Factor (rmLIF) produced in E. coli is a single non-glycosylated polypeptide chain containing 180 amino acids. A fully biologically active molecule, rmLIF has a molecular mass of 19.9 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 180
Description : Leukemia Inhibitory Factor (LIF) is a pleiotropic cytokine belonging to the long four-helix bundle cytokine superfamily. LIF shares tertiary structure with several other cytokines, including Interleukin-6 (IL-6), Oncostatin M, ciliary neurotropic factor, and cardiotrophin-1, and their functions in vivo are also redundant to some extent. LIF can bind to the common receptor of IL-6 subfamily, gp130, and then recruit its own receptor LIF Receptor to form a ternary complex. The basal expression of LIF in vivo is low; and its expression is induced by pro-inflammatory factors, including lipopolysaccharide, IL-1, and IL-17, and inhibited by anti-inflammatory agents, including IL-4 and IL-13. The functions of LIF include proliferation of primordial germ cells, regulation in blastocyst implantation and early pregnancy, and maintenance of pluripotent embryonic stem cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.01 ng/mL, measured by a cell differentiation assay using M1 cells, corresponding to a specific activity of > 1.0 × 10^8 units/mg.
Molecular Mass : 19.9 kDa, observed by reducing SDS-PAGE.
AA Sequence : SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant mouse Leukemia Inhibitory Factor (rmLIF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmLIF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50 mM Tris, 150 mM NaCl, pH8.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Lif leukemia inhibitory factor [ Mus musculus ]
Official Symbol Lif
Synonyms LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor;
Gene ID 16878
mRNA Refseq NM_001039537
Protein Refseq NP_001034626
UniProt ID P09056

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lif Products

Required fields are marked with *

My Review for All Lif Products

Required fields are marked with *

0

Inquiry Basket

cartIcon