Active Recombinant Mouse Lif Protein (180 aa)
Cat.No. : | Lif-340L |
Product Overview : | Recombinant mouse Leukemia Inhibitory Factor (rmLIF) produced in E. coli is a single non-glycosylated polypeptide chain containing 180 amino acids. A fully biologically active molecule, rmLIF has a molecular mass of 19.9 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 180 |
Description : | Leukemia Inhibitory Factor (LIF) is a pleiotropic cytokine belonging to the long four-helix bundle cytokine superfamily. LIF shares tertiary structure with several other cytokines, including Interleukin-6 (IL-6), Oncostatin M, ciliary neurotropic factor, and cardiotrophin-1, and their functions in vivo are also redundant to some extent. LIF can bind to the common receptor of IL-6 subfamily, gp130, and then recruit its own receptor LIF Receptor to form a ternary complex. The basal expression of LIF in vivo is low; and its expression is induced by pro-inflammatory factors, including lipopolysaccharide, IL-1, and IL-17, and inhibited by anti-inflammatory agents, including IL-4 and IL-13. The functions of LIF include proliferation of primordial germ cells, regulation in blastocyst implantation and early pregnancy, and maintenance of pluripotent embryonic stem cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.01 ng/mL, measured by a cell differentiation assay using M1 cells, corresponding to a specific activity of > 1.0 × 10^8 units/mg. |
Molecular Mass : | 19.9 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant mouse Leukemia Inhibitory Factor (rmLIF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmLIF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 50 mM Tris, 150 mM NaCl, pH8.0. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Lif leukemia inhibitory factor [ Mus musculus ] |
Official Symbol | Lif |
Synonyms | LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor; |
Gene ID | 16878 |
mRNA Refseq | NM_001039537 |
Protein Refseq | NP_001034626 |
UniProt ID | P09056 |
◆ Recombinant Proteins | ||
LIF-2031H | Active Recombinant Human LIF protein, His-tagged | +Inquiry |
Lif-57M | Active Recombinant Mouse Lif Protein | +Inquiry |
LIF-2753C | Recombinant Cattle LIF Protein, His-tagged | +Inquiry |
Lif-719M | Active Recombinant Mouse Lif, His-tagged, Biotinylated | +Inquiry |
LIF-35H | Recombinant Human LIF Protein (Ready-to-Use) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lif Products
Required fields are marked with *
My Review for All Lif Products
Required fields are marked with *
0
Inquiry Basket