Recombinant Rat Lif protein

Cat.No. : Lif-733R
Product Overview : Recombinant Rat Lif protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 180
Description : A secreted cytokine, involved in embryonic stem cell and myeloid cell growth and differentiation and stimulation of bone remodeling.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 1 × PBS, pH 7.4.
Molecular Mass : Approximately 19.8 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids.
AA Sequence : SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF
Endotoxin : Less than 0.1 EU/μg of rRtLIF as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Lif
Official Symbol Lif
Synonyms LIF; leukemia inhibitory factor; cholinergic neuronal differentiation factor; leukemia inhibitory factor (cholinergic differentiation factor);
Gene ID 60584
mRNA Refseq NM_022196
Protein Refseq NP_071532
UniProt ID P17777

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lif Products

Required fields are marked with *

My Review for All Lif Products

Required fields are marked with *

0
cart-icon
0
compare icon