Active Recombinant Mouse Lif Protein (181 aa)

Cat.No. : Lif-043L
Product Overview : Recombinant Mouse Lif Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 181
Description : Leukemia Inhibitory Factor (LIF) is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency,bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Mouse LIF is a 20 kDa protein containing 181 amino acid residues.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The activity of mouse LIF is determined by the ability to induce differentiation of murine M1myeloid leukemic cells. The minimum detectable concentration of mouse LIF in this assay is0.5 ng/mL. The specific activity is >1 × 10^8 units/mg, where 50 units is defined as the amountof mouse LIF required to induce differentiation in 50% of the M1 colonies in 1 mL agarcultures.
Molecular Mass : Approximately20 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
AA Sequence : MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Endotoxin : Less than 1 EU/mg of rmLIF as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Lif leukemia inhibitory factor [ Mus musculus ]
Official Symbol Lif
Synonyms LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor;
Gene ID 16878
mRNA Refseq NM_001039537
Protein Refseq NP_001034626
UniProt ID P09056

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lif Products

Required fields are marked with *

My Review for All Lif Products

Required fields are marked with *

0
cart-icon