Active Recombinant Human LIF, Fc-tagged, Biotinylated
Cat.No. : | LIF-635H |
Product Overview : | The recombinant human LIF-Fc fusion is expressed as a 419amino acid protein consisting of Ser23 - Phe202 region of (UniProt accession #P15018) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 23-202 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.1 - 0.2 ng/ml. Induce IL-6 secretion in M1 mouse myeloid leukemia cells. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency. |
Molecular Mass : | Calculated molecular mass (kDa): 46.5; Estimated by SDS-PAGE under reducing condition (kDa): 60-65 (probably due to glycosylation) |
AA Sequence : | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANG TEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGP DTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | LIF leukemia inhibitory factor [ Homo sapiens ] |
Official Symbol | LIF |
Synonyms | LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI; |
Gene ID | 3976 |
mRNA Refseq | NM_001257135 |
Protein Refseq | NP_001244064 |
MIM | 159540 |
UniProt ID | P15018 |
Chromosome Location | 22q12.2 |
Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; leukemia inhibitory factor receptor binding; leukemia inhibitory factor receptor binding; receptor binding; |
◆ Recombinant Proteins | ||
LIF-207M | Active Recombinant Mouse LIF Protein | +Inquiry |
Lif-340L | Active Recombinant Mouse Lif Protein (180 aa) | +Inquiry |
Lif-33M | Active Recombinant Mouse Lif Protein (Ready-to-Use, 181 amino acid) | +Inquiry |
LIF-02H | Recombinant Human LIF Protein, His-tagged | +Inquiry |
LIF-11H | Recombinant Human LIF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *
0
Inquiry Basket