Active Recombinant Mouse LIF Protein

Cat.No. : LIF-207M
Product Overview : Recombinant Mouse LIF Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Leukemia inhibitory factor (LIF) is a member of the interleukin 6 (IL-6) family that is made by a variety of adult and embryonic tissues. LIF signals through the glycoprotein 130 (gp130)/LIF receptor (LIFR) heterodimer to activate STAT3 and MAPK signaling. LIF functions during hematopoietic differentiation, neuronal cell differentiation, kidney development, and inflammatory processes. Mouse LIF promotes mouse embryonic stem (ES) cell self-renewal and pluripotency in long-term cell culture systems, similar to the functional activity of FGF-basic in human ES cell culture systems.
Bio-activity : IL-6 production by M1 cells, ≤1 ng/mL
Molecular Mass : Monomer, 20 kDa (181 aa)
AA Sequence : MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile 10 mM acetic acid at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Lif leukemia inhibitory factor [ Mus musculus (house mouse) ]
Official Symbol LIF
Synonyms LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor;
Gene ID 16878
mRNA Refseq NM_001039537
Protein Refseq NP_001034626
UniProt ID P09056

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIF Products

Required fields are marked with *

My Review for All LIF Products

Required fields are marked with *

0
cart-icon