Active Recombinant Mouse Pdgfb Protein
Cat.No. : | Pdgfb-4757M |
Product Overview : | Purified recombinant protein of Mouse platelet derived growth factor, B polypeptide (Pdgfb) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA. |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The expected ED50 for this effect is 1.0-2.0 ng/mL. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Pdgfb platelet derived growth factor, B polypeptide [ Mus musculus (house mouse) ] |
Official Symbol | Pdgfb |
Synonyms | PDGFB; platelet derived growth factor, B polypeptide; platelet-derived growth factor subunit B; c-sis; PDGF-2; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor B chain; platelet-derived growth factor beta polypeptide; Sis; PDGF-B |
Gene ID | 18591 |
mRNA Refseq | NM_011057 |
Protein Refseq | NP_035187 |
UniProt ID | P31240 |
◆ Recombinant Proteins | ||
PDGFB-301367H | Recombinant Human PDGFB protein, GST-tagged | +Inquiry |
Pdgfb-55M | Recombinant Mouse Pdgfb protein | +Inquiry |
PDGFB-035E | Active Recombinant Human PDGFB (82-190aa) | +Inquiry |
Pdgfb-23B | Recombinant Bovine PDGF-BB Protein, Ser82-Thr190 | +Inquiry |
PDGFB-33H | Recombinant Human PDGFB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pdgfb Products
Required fields are marked with *
My Review for All Pdgfb Products
Required fields are marked with *
0
Inquiry Basket