Active Recombinant Human PDGFB Protein
| Cat.No. : | PDGFB-224H |
| Product Overview : | Recombinant Human PDGFB Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Platelet-derived growth factor (PDGF) is an important regulator of cell growth, proliferation, and angiogenesis. PDGF synthesis is induced by IL-1, IL-6, TNF-α, TGF-β, and EGF signaling. PDGF functions as a mitogenic growth hormone on cells of mesenchymal lineage, such as smooth muscle and glial cells. PDGF is also stored in the alpha-granules of platelets and is released upon adherence to traumatized tissues. PDGF is a dimeric glycoprotein formed by two A chains (AA), two B chains (BB), or as a heterodimer with an A and a B chain (AB). The PDGF dimer binds the cell surface receptor tyrosine kinases PDGFR-α and PDGFR-β. |
| Bio-activity : | 3T3 cell proliferation, ≤20 ng/mL; ≥5.0 x 10^4 units/mg |
| Molecular Mass : | Dimer, 12.4/24.9 kDa (110/220 aa) |
| AA Sequence : | MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens (human) ] |
| Official Symbol | PDGFB |
| Synonyms | PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog) , SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858; |
| Gene ID | 5155 |
| mRNA Refseq | NM_002608 |
| Protein Refseq | NP_002599 |
| MIM | 190040 |
| UniProt ID | P01127 |
| ◆ Recombinant Proteins | ||
| PDGFB-1175P | Recombinant Pig PDGFB Protein, His-tagged | +Inquiry |
| PDGFB-4402M | Recombinant Mouse PDGFB Protein | +Inquiry |
| PDGFB-377H | Active Recombinant Human PDGFB protein, His-Avi-tagged | +Inquiry |
| PDGFB-515H | Active Recombinant Human PDGFB Protein, His-tagged | +Inquiry |
| PDGFB-528H | Recombinant Human PDGFB protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFB Products
Required fields are marked with *
My Review for All PDGFB Products
Required fields are marked with *



