Active Recombinant Mouse/Rat CCL5 Protein

Cat.No. : Ccl5-29M
Product Overview : Recombinant Mouse/Rat CCL5 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse/Rat
Source : E.coli
Description : Regulated upon activation, normal T cell expressed and secreted (RANTES), also called CCL5, is a chemokine produced by T cells three to five days after T cell activation. RANTES signals through G protein-coupled receptors CCR5, CCR3, CCR1, and through the human CMV-encoded viral receptor US28. RANTES functions to recruit immune cells to inflammatory sites.
Bio-activity : THP-1 chemotaxis, ≤250 ng/mL
Molecular Mass : Monomer, 7.9 kDa (68 aa)
AA Sequence : SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Ccl5 chemokine (C-C motif) ligand 5 [ Mus musculus (house mouse) ]
Official Symbol Ccl5
Synonyms CCL5; chemokine (C-C motif) ligand 5; C-C motif chemokine 5; SIS-delta; small inducible cytokine A5; small-inducible cytokine A5; T-cell-specific protein RANTES; SISd; Scya5; RANTES; TCP228; MuRantes;
Gene ID 20304
mRNA Refseq NM_013653
Protein Refseq NP_038681
UniProt ID Q5XZF2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl5 Products

Required fields are marked with *

My Review for All Ccl5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon