| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
TWEAK belongs to the TNF family of ligands, and also known as TNFRSF12A through TWEAK receptor signaling. TWEAK wildly expresses in a variety of tissues, including the adult heart, pancreas, skeletal muscle, small intestine, spleen and peripheral blood lymphocytes. TWEAK has the ability to trigger activation and chemokine secretion of NF-κB, and to apply an apoptotic activity in certain cells, such as HT-29 human cultured adenocarcinoma cells feeding with IFN-γ. TWEAK also promotes proliferation and migration of endothelial cells. |
| Form : |
Lyophilized powder |
| AA Sequence : |
MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLV
NGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : |
Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <0.2 μg/mL. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : |
Please use within one month after protein reconstitution. |
