Active Recombinant Porcine CSF2 Protein
Cat.No. : | CSF2-45P |
Product Overview : | Recombinant Porcine CSF2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Description : | Granulocyte-macrophage colony-stimulating factor (GM-CSF) is a hematopoietic growth factor produced by endothelial cells, monocytes, fibroblasts, and T cells. GM-CSF stimulates the production of neutrophilic granulocytes, macrophages, and mixed granulocyte-macrophage colonies from bone marrow cells. GM-CSF promotes immune system development and regulates neutrophil function during infection. |
Bio-activity : | TF-1 cell proliferation, ED50≤15 ng/mL |
Molecular Mass : | Monomer, 14.4 kDa (with 128 amino acids) |
AA Sequence : | MAPTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCWKPVKK |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Canis lupus familiaris (dog) ] |
Official Symbol | CSF2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; GM-CSF; |
Gene ID | 403923 |
mRNA Refseq | NM_001003245 |
Protein Refseq | NP_001003245 |
UniProt ID | P48749 |
◆ Recombinant Proteins | ||
CSF2-27473TH | Recombinant Human CSF2 | +Inquiry |
CSF2-347M | Recombinant Mouse Csf2, Fc tagged | +Inquiry |
Csf2-539M | Recombinant Mouse Csf2 protein, His & GST-tagged | +Inquiry |
Csf2-391C | Active Recombinant Mouse Csf2 Protein (125 aa) | +Inquiry |
CSF2-158H | Recombinant Human CSF2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2 Products
Required fields are marked with *
My Review for All CSF2 Products
Required fields are marked with *
0
Inquiry Basket