Recombinant Full Length Human CSF2 Protein, GST-tagged
Cat.No. : | CSF2-2157HF |
Product Overview : | Human CSF2 full-length ORF ( AAI14000.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 144 amino acids |
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 42.7 kDa |
AA Sequence : | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ] |
Official Symbol | CSF2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897 |
Gene ID | 1437 |
mRNA Refseq | NM_000758 |
Protein Refseq | NP_000749 |
MIM | 138960 |
UniProt ID | P04141 |
◆ Recombinant Proteins | ||
Csf2-19M | Active Recombinant Mouse Csf2 Protein (Ala18-Lys141), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CSF2-86H | Recombinant Human Colony Stimulating Factor 2(Granulocyte-macrophage) | +Inquiry |
CSF2-467C | Recombinant Canine CSF2 protein | +Inquiry |
CSF2-347M | Recombinant Mouse Csf2, Fc tagged | +Inquiry |
Csf2-045M | Active Recombinant Mouse Csf2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2 Products
Required fields are marked with *
My Review for All CSF2 Products
Required fields are marked with *