Active Recombinant Porcine FLT-3 Ligand Protein

Cat.No. : FLT3-98P
Product Overview : Recombinant Porcine FLT-3 Ligand Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Description : Fms-related tyrosine kinase 3 ligand (FLT-3 ligand) is a growth factor that regulates hematopoietic cell proliferation. FLT-3 ligand signaling is transmitted through the fms-related tyrosine kinase 3 (FLT-3) receptor. FLT-3 ligand promotes the long-term expansion and differentiation of pro-B cells in the presence of interleukin 7 (IL-7) or in combination of IL-7 and interleukin 3 (IL-3).
Bio-activity : OCI-AML5 cell proliferation, ED50≤5 ng/mL
Molecular Mass : Monomer, 17.3 kDa (with 155 amino acids)
AA Sequence : MSPDCSFPHSPISSTFANTIRQLSDYLLQDYPVTVASNLQDDELCGAFWRLVLAQRWMGQLKTVAGSQMQKLLEAVNTEIVFVTSCALQPLPSCLRFVQANISHLLQDTSQQLVALKPWITRRNFSRCLELQCQPDPSTLLPPRSPGALEATSLP
Endotoxin : ≤1 EUs/μg, Kinetic LAL (50% confidence)
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name FLT3 fms-related tyrosine kinase 3 [ Sus scrofa (pig) ]
Official Symbol FLT3
Synonyms FLT3; fms-related tyrosine kinase 3;
Gene ID 100515445
mRNA Refseq XM_021065521
Protein Refseq XP_020921180
UniProt ID D2K7D6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT3 Products

Required fields are marked with *

My Review for All FLT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon