Active Recombinant Rat CSF2 Protein

Cat.No. : CSF2-48R
Product Overview : Recombinant Rat CSF2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is hematopoietic factor produced by entothelial cells, monocytes, fibroblasts and T cells in response to a number of inflammatory mediators. GM-CSF is able to stimulate the production of neutrophilic granulocytes, macrophages, and mixed granulocyte-macrophage colonies from bone marrow cells. GM-CSF can also stimulate some functional activities in mature granulocytes and macrophages. Human and mouse GM-CSF show no cross-reactivity.
Bio-activity : FDC-P1 cell proliferation, ≤20 pg/mL
Molecular Mass : Monomer, 14.7 kDa (128 aa)
AA Sequence : MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20ºC
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM sodium bicarbonate, pH 8.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Rattus norvegicus (Norway rat) ]
Official Symbol CSF2
Synonyms CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; Gmcsf; Gm-csf;
Gene ID 116630
mRNA Refseq NM_053852
Protein Refseq NP_446304
UniProt ID P48750

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF2 Products

Required fields are marked with *

My Review for All CSF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon